HORDB

General Information

ID: hor006341
Uniprot ID: Q9VT53
Protein name: Probable insulin-like peptide 4 A chain
Gene name: Ilp4
Organism: Drosophila melanogaster (Fruit fly)
Family: Insulin family
Source: animal
Expression: Expressed in the embryo (beginning at the blastoderm stage), and in the larva. |Expressed at a high level in the embryonic mesoderm, with expression continuing after gastrulation and reducing from stage 12 onwards. Highly expressed in the embryonic anteri
Disease: NA
Comments: NA
Taxonomy: melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding; GO:0005158 insulin receptor binding; GO:0005179 hormone activity
GO BP: GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway; GO:0008286 insulin receptor signaling pathway; GO:0030536 larval feeding behavior
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

Sequence: IAHECCKEGCTYDDILDYCA
Length: 20(115-134)
Propeptide: MSLIRLGLALLLLLATVSQLLQPVQGRRKMCGEALIQALDVICVNGFTRRVRRSSASKDARVRDLIRKLQQPDEDIEQETETGRLKQKHTDADTEKGVPPAVGSGRKLRRHRRRIAHECCKEGCTYDDILDYCA
Signal peptide: MSLIRLGLALLLLLATVSQLLQPVQG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Activity

Function: NA
Mechanism: NA
Cross BBB: NA
Target: InR
Target Unid: P09208
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: 45787
Structure ID: AF-Q9VT53-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006341_AF2.pdb

hor006341_ESM.pdb

Physical Information

Mass:	260465	Formula:	C94H141N23O34S4
Absent amino acids:	FMNPQRSVW	Common amino acids:	C
pI:	3.92	Basic residues:	2
Polar residues:	8	Hydrophobic residues:	5
Hydrophobicity:	-9.5	Boman Index:	-2840
Half-Life:	20 hour	Half-Life Yeast:	30 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	68.5
Instability Index:	6499.5	Extinction Coefficient cystines:	3230
Absorbance 280nm:	170

Literature

PubMed ID: 10731132
Title: The genome sequence of Drosophila melanogaster.
PubMed ID: 12537572
Title: Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
PubMed ID: 12537569
Title: A Drosophila full-length cDNA resource.
PubMed ID: 11250149
Title: An evolutionarily conserved function of the Drosophila insulin receptor and insul